Lineage for d1cloh2 (1clo H:114-214)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289267Domain d1cloh2: 1clo H:114-214 [21153]
    Other proteins in same PDB: d1cloh1, d1clol1, d1clol2
    part of Fab A5B7

Details for d1cloh2

PDB Entry: 1clo (more details), 2.1 Å

PDB Description: anti-carcinoembryonic antigen monoclonal antibody a5b7

SCOP Domain Sequences for d1cloh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cloh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d1cloh2:

Click to download the PDB-style file with coordinates for d1cloh2.
(The format of our PDB-style files is described here.)

Timeline for d1cloh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cloh1