![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class alpha GST [81360] (8 species) |
![]() | Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (35 PDB entries) Uniprot P08263 |
![]() | Domain d3i6aa1: 3i6a A:2-80 [211518] Other proteins in same PDB: d3i6aa2, d3i6ab2, d3i6ac2, d3i6ad2, d3i6ae2, d3i6af2, d3i6ag2, d3i6ah2 automated match to d1k3ya2 complexed with gsh; mutant |
PDB Entry: 3i6a (more details), 1.98 Å
SCOPe Domain Sequences for d3i6aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i6aa1 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid gmklvqtrailnyiaskyn
Timeline for d3i6aa1: