Lineage for d3i69c1 (3i69 C:2-80)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1852841Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1852852Protein Class alpha GST [81360] (8 species)
  7. 1852865Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (27 PDB entries)
    Uniprot P08263
  8. 1852942Domain d3i69c1: 3i69 C:2-80 [211506]
    Other proteins in same PDB: d3i69a2, d3i69b2, d3i69c2, d3i69d2, d3i69e2, d3i69f2, d3i69g2, d3i69h2
    automated match to d1k3ya2
    complexed with gsh; mutant

Details for d3i69c1

PDB Entry: 3i69 (more details), 2.38 Å

PDB Description: apo glutathione transferase a1-1 gimf-helix mutant
PDB Compounds: (C:) glutathione s-transferase a1

SCOPe Domain Sequences for d3i69c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i69c1 c.47.1.5 (C:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

SCOPe Domain Coordinates for d3i69c1:

Click to download the PDB-style file with coordinates for d3i69c1.
(The format of our PDB-style files is described here.)

Timeline for d3i69c1: