SCOPe 2.06: Domain d3i69b1: 3i69 B:2-80

Lineage for d3i69b1 (3i69 B:2-80)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [52870] (30 PDB entries)
   Uniprot P08263

8. Domain d3i69b1: 3i69 B:2-80 [211504]
   Other proteins in same PDB: d3i69a2, d3i69b2, d3i69c2, d3i69d2, d3i69e2, d3i69f2, d3i69g2, d3i69h2
   automated match to d1k3ya2
   complexed with gsh; mutant

Details for d3i69b1

PDB Entry: 3i69, 2.38 Å

PDB Description: apo glutathione transferase a1-1 gimf-helix mutant

PDB Compounds: (B:) glutathione s-transferase a1

SCOPe Domain Sequences for d3i69b1:

Sequence; same for both SEQRES and ATOM records:

>d3i69b1 c.47.1.5 (B:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
aekpklhyfngrgrmestrwllaaagvefeekfiksaedldklrndgylmfqqvpmveid
gmklvqtrailnyiaskyn

Timeline for d3i69b1:

• d3i69b1 first appeared in SCOPe 2.03
  
• d3i69b1 appears in SCOPe 2.05
  
• d3i69b1 appears in SCOPe 2.07
  
• d3i69b1 appears in the current release, SCOPe 2.08