Lineage for d1fj1c2 (1fj1 C:108-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656374Domain d1fj1c2: 1fj1 C:108-213 [21150]
    Other proteins in same PDB: d1fj1a1, d1fj1b1, d1fj1b2, d1fj1c1, d1fj1d1, d1fj1d2, d1fj1e_, d1fj1f_
    part of Fab LA-2 against OspA

Details for d1fj1c2

PDB Entry: 1fj1 (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
PDB Compounds: (C:) hybridoma antibody la2 (light chain)

SCOP Domain Sequences for d1fj1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj1c2 b.1.1.2 (C:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOP Domain Coordinates for d1fj1c2:

Click to download the PDB-style file with coordinates for d1fj1c2.
(The format of our PDB-style files is described here.)

Timeline for d1fj1c2: