SCOPe 2.06: Domain d3i4va_: 3i4v A:

Lineage for d3i4va_ (3i4v A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.0: automated matches [227249] (1 protein)
   not a true family

6. Protein automated matches [227026] (4 species)
   not a true protein

7. Species Rhodococcus opacus [TaxId:37919] [225810] (11 PDB entries)

8. Domain d3i4va_: 3i4v A: [211493]
   automated match to d1s9aa_
   complexed with 3ce, 6pl, fe

Details for d3i4va_

PDB Entry: 3i4v, 2 Å

PDB Description: Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1CP in complex with 3-chlorocatechol

PDB Compounds: (A:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d3i4va_:

Sequence; same for both SEQRES and ATOM records:

>d3i4va_ b.3.6.0 (A:) automated matches {Rhodococcus opacus [TaxId: 37919]}
atadtsperlaaiakdalgalndvilkhgvtypeyrvfkqwlidvgeggewplfldvfie
hsveevlarsrkgtmgsiegpyyienspelpskctlpmreedekitplvfsgqvtdldgn
glagakvelwhadndgyysqfaphlpewnlrgtiiadeegryeittiqpapyqiptdgpt
gqfieaqnghpwrpahlhlivsapgkesvttqlyfkggewidsdvasatkpelildpktg
ddgknyvtynfvldpa

Timeline for d3i4va_:

• d3i4va_ first appeared in SCOPe 2.03
  
• d3i4va_ appears in SCOPe 2.05
  
• d3i4va_ appears in SCOPe 2.07
  
• d3i4va_ appears in the current release, SCOPe 2.08