SCOPe 2.05: Domain d3i4qa_: 3i4q A:

Lineage for d3i4qa_ (3i4q A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.5: Inorganic pyrophosphatase [50324] (2 families)

5. Family b.40.5.0: automated matches [191399] (1 protein)
   not a true family

6. Protein automated matches [190523] (11 species)
   not a true protein

7. Species Oleispira antarctica [TaxId:188908] [225731] (1 PDB entry)

8. Domain d3i4qa_: 3i4q A: [211492]
   automated match to d2bqya_
   complexed with na

Details for d3i4qa_

PDB Entry: 3i4q, 1.63 Å

PDB Description: Structure of a putative inorganic pyrophosphatase from the oil-degrading bacterium Oleispira antarctica

PDB Compounds: (A:) apc40078

SCOPe Domain Sequences for d3i4qa_:

Sequence, based on SEQRES records:

>d3i4qa_ b.40.5.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]}
yntipagkdlpndiyvaieipanaspikyeidkdmdallvdrfmatpmfypanygyinnt
laddgdaldvlvitpypvapgsvirarpvgvlkmsdeaggdekllavphekltqlyndih
diddvpqllkdqivhffehykdlekgkwvkvegwenadaaraaivksaaaykg

Sequence, based on observed residues (ATOM records):

>d3i4qa_ b.40.5.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]}
yntipagkdlpndiyvaieipanaspikyeidmdallvdrfmatpmfypanygyinntla
ddgdaldvlvitpypvapgsvirarpvgvlkmsdeaggdekllavphekltqlyndihdi
ddvpqllkdqivhffehykdlegkwvkvegwenadaaraaivksaaaykg

Timeline for d3i4qa_:

• d3i4qa_ first appeared in SCOPe 2.03
  
• d3i4qa_ appears in SCOPe 2.04
  
• d3i4qa_ appears in SCOPe 2.06
  
• d3i4qa_ appears in the current release, SCOPe 2.08