Lineage for d3i4kh2 (3i4k H:133-374)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1573949Species Corynebacterium glutamicum [TaxId:1718] [225728] (1 PDB entry)
  8. 1573957Domain d3i4kh2: 3i4k H:133-374 [211491]
    Other proteins in same PDB: d3i4ka1, d3i4kb1, d3i4kc1, d3i4kd1, d3i4ke1, d3i4kf1, d3i4kg1, d3i4kh1
    automated match to d1f9ca1
    complexed with acy, mg

Details for d3i4kh2

PDB Entry: 3i4k (more details), 2.2 Å

PDB Description: crystal structure of muconate lactonizing enzyme from corynebacterium glutamicum
PDB Compounds: (H:) muconate lactonizing enzyme

SCOPe Domain Sequences for d3i4kh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i4kh2 c.1.11.0 (H:133-374) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
tvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrvaelarevg
drvslridinarwdrrtalhylpilaeagvelfeqptpaddletlreitrrtnvsvmade
svwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglachgatslegpigta
aslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpglgvdvdmdkvnfy
tr

SCOPe Domain Coordinates for d3i4kh2:

Click to download the PDB-style file with coordinates for d3i4kh2.
(The format of our PDB-style files is described here.)

Timeline for d3i4kh2: