Lineage for d1fj1b2 (1fj1 B:115-213)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358964Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2359291Species Mouse (Mus musculus) [TaxId:10090] [88576] (429 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 2359609Domain d1fj1b2: 1fj1 B:115-213 [21149]
    Other proteins in same PDB: d1fj1a1, d1fj1a2, d1fj1b1, d1fj1c1, d1fj1c2, d1fj1d1, d1fj1e_, d1fj1f_
    part of Fab LA-2 against OspA

Details for d1fj1b2

PDB Entry: 1fj1 (more details), 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2
PDB Compounds: (B:) hybridoma antibody la2 (heavy chain)

SCOPe Domain Sequences for d1fj1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fj1b2 b.1.1.2 (B:115-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
ytmsssvtvpsstwpsqtvtcsvahpassttvdkkleps

SCOPe Domain Coordinates for d1fj1b2:

Click to download the PDB-style file with coordinates for d1fj1b2.
(The format of our PDB-style files is described here.)

Timeline for d1fj1b2: