SCOP 1.57: Domain d1fj1b2: 1fj1 B:115-213

Lineage for d1fj1b2 (1fj1 B:115-213)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab LA-2 (mouse), kappa L chain [49037] (1 PDB entry)

8. Domain d1fj1b2: 1fj1 B:115-213 [21149]
   Other proteins in same PDB: d1fj1a1, d1fj1b1, d1fj1c1, d1fj1d1, d1fj1e_, d1fj1f_

Details for d1fj1b2

PDB Entry: 1fj1, 2.68 Å

PDB Description: lyme disease antigen ospa in complex with neutralizing antibody fab la-2

SCOP Domain Sequences for d1fj1b2:

Sequence; same for both SEQRES and ATOM records:

>d1fj1b2 b.1.1.2 (B:115-213) Immunoglobulin (constant domains of L and H chains) {Fab LA-2 (mouse), kappa L chain}
kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
ytmsssvtvpsstwpsqtvtcsvahpassttvdkkleps

Timeline for d1fj1b2:

• d1fj1b2 first appeared (with stable ids) in SCOP 1.55
  
• d1fj1b2 appears in SCOP 1.59
  
• d1fj1b2 appears in the current release, SCOPe 2.08