SCOPe 2.06: Domain d3i4ke1: 3i4k E:5-132

Lineage for d3i4ke1 (3i4k E:5-132)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [225727] (1 PDB entry)

8. Domain d3i4ke1: 3i4k E:5-132 [211484]
   Other proteins in same PDB: d3i4ka2, d3i4kb2, d3i4kc2, d3i4kd2, d3i4ke2, d3i4kf2, d3i4kg2, d3i4kh2
   automated match to d1f9ca2
   complexed with acy, mg

Details for d3i4ke1

PDB Entry: 3i4k, 2.2 Å

PDB Description: crystal structure of muconate lactonizing enzyme from corynebacterium glutamicum

PDB Compounds: (E:) muconate lactonizing enzyme

SCOPe Domain Sequences for d3i4ke1:

Sequence; same for both SEQRES and ATOM records:

>d3i4ke1 d.54.1.0 (E:5-132) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgge
svetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnv
pvrdllgg

Timeline for d3i4ke1:

• d3i4ke1 first appeared in SCOPe 2.03
  
• d3i4ke1 appears in SCOPe 2.05
  
• d3i4ke1 appears in SCOPe 2.07
  
• d3i4ke1 appears in the current release, SCOPe 2.08