Lineage for d3i4ke1 (3i4k E:6-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948152Species Corynebacterium glutamicum [TaxId:1718] [225727] (1 PDB entry)
  8. 2948157Domain d3i4ke1: 3i4k E:6-132 [211484]
    Other proteins in same PDB: d3i4ka2, d3i4ka3, d3i4kb2, d3i4kb3, d3i4kc2, d3i4kc3, d3i4kd2, d3i4kd3, d3i4ke2, d3i4ke3, d3i4kf2, d3i4kf3, d3i4kg2, d3i4kg3, d3i4kh2, d3i4kh3
    automated match to d1f9ca2
    complexed with acy, mg

Details for d3i4ke1

PDB Entry: 3i4k (more details), 2.2 Å

PDB Description: crystal structure of muconate lactonizing enzyme from corynebacterium glutamicum
PDB Compounds: (E:) muconate lactonizing enzyme

SCOPe Domain Sequences for d3i4ke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i4ke1 d.54.1.0 (E:6-132) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
ltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgges
vetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnvp
vrdllgg

SCOPe Domain Coordinates for d3i4ke1:

Click to download the PDB-style file with coordinates for d3i4ke1.
(The format of our PDB-style files is described here.)

Timeline for d3i4ke1: