![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [225727] (1 PDB entry) |
![]() | Domain d3i4ke1: 3i4k E:6-132 [211484] Other proteins in same PDB: d3i4ka2, d3i4ka3, d3i4kb2, d3i4kb3, d3i4kc2, d3i4kc3, d3i4kd2, d3i4kd3, d3i4ke2, d3i4ke3, d3i4kf2, d3i4kf3, d3i4kg2, d3i4kg3, d3i4kh2, d3i4kh3 automated match to d1f9ca2 complexed with acy, mg |
PDB Entry: 3i4k (more details), 2.2 Å
SCOPe Domain Sequences for d3i4ke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i4ke1 d.54.1.0 (E:6-132) automated matches {Corynebacterium glutamicum [TaxId: 1718]} ltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgges vetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnvp vrdllgg
Timeline for d3i4ke1: