| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (67 species) not a true protein |
| Species Corynebacterium glutamicum [TaxId:1718] [225727] (1 PDB entry) |
| Domain d3i4kb1: 3i4k B:5-132 [211478] Other proteins in same PDB: d3i4ka2, d3i4kb2, d3i4kc2, d3i4kd2, d3i4ke2, d3i4kf2, d3i4kg2, d3i4kh2 automated match to d1f9ca2 complexed with acy, mg |
PDB Entry: 3i4k (more details), 2.2 Å
SCOPe Domain Sequences for d3i4kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i4kb1 d.54.1.0 (B:5-132) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dltiqkvesrildvplirphgfatttsteqhillvsvhlengvigygegvvpggpwwgge
svetmkalvdgylapvligravselagimadlervvararyakaavdvamhdawarslnv
pvrdllgg
Timeline for d3i4kb1: