Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (79 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:1718] [225728] (1 PDB entry) |
Domain d3i4ka2: 3i4k A:133-374 [211477] Other proteins in same PDB: d3i4ka1, d3i4ka3, d3i4kb1, d3i4kb3, d3i4kc1, d3i4kc3, d3i4kd1, d3i4kd3, d3i4ke1, d3i4ke3, d3i4kf1, d3i4kf3, d3i4kg1, d3i4kg3, d3i4kh1, d3i4kh3 automated match to d1f9ca1 complexed with acy, mg |
PDB Entry: 3i4k (more details), 2.2 Å
SCOPe Domain Sequences for d3i4ka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i4ka2 c.1.11.0 (A:133-374) automated matches {Corynebacterium glutamicum [TaxId: 1718]} tvrdkvdvtwalgvlpldvavaeieerieefgnrsfklkmgagdpaedtrrvaelarevg drvslridinarwdrrtalhylpilaeagvelfeqptpaddletlreitrrtnvsvmade svwtpaealavvkaqaadvialkttkhgglleskkiaaiaeagglachgatslegpigta aslqfaastkaisygtelfgpqllkdtyivqefeykdgqvaipqgpglgvdvdmdkvnfy tr
Timeline for d3i4ka2: