Lineage for d3i4ia_ (3i4i A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779081Family b.29.1.2: Glycosyl hydrolases family 16 [49925] (7 proteins)
    Pfam PF00722
    beta-Glucanase-like
  6. 2779165Protein automated matches [191047] (8 species)
    not a true protein
  7. 2779182Species Uncultured murine [TaxId:314099] [225925] (1 PDB entry)
  8. 2779183Domain d3i4ia_: 3i4i A: [211474]
    automated match to d2ayha_
    complexed with ca

Details for d3i4ia_

PDB Entry: 3i4i (more details), 1.89 Å

PDB Description: Crystal structure of a prokaryotic beta-1,3-1,4-glucanase (lichenase) derived from a mouse hindgut metagenome
PDB Compounds: (A:) 1,3-1,4-beta-glucanase

SCOPe Domain Sequences for d3i4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i4ia_ b.29.1.2 (A:) automated matches {Uncultured murine [TaxId: 314099]}
vfthfgegfdyydsqlwekadgwgnggvfnciwraynielkdgilnlsitddmpssskpy
agaeyrtrdkfgyglyqvrmkpaknpgivssfftytgpvhgtpwdeidieflgkdttkvq
fnyytnsagnheyiydlrfdasedfhiyafnwqpnyiawlvdgeevyrayddipvhpgki
mlniwpgigvdewlgaydgktnltasydwvaydpi

SCOPe Domain Coordinates for d3i4ia_:

Click to download the PDB-style file with coordinates for d3i4ia_.
(The format of our PDB-style files is described here.)

Timeline for d3i4ia_: