SCOP 1.65: Domain d1osph2: 1osp H:121-218

Lineage for d1osph2 (1osp H:121-218)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)

8. Domain d1osph2: 1osp H:121-218 [21147]
   Other proteins in same PDB: d1osph1, d1ospl1, d1ospl2, d1ospo_
   part of Fab 184.1 against OspA
   mutant

Details for d1osph2

PDB Entry: 1osp, 1.95 Å

PDB Description: crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab

SCOP Domain Sequences for d1osph2:

Sequence; same for both SEQRES and ATOM records:

>d1osph2 b.1.1.2 (H:121-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg
lytmsssvtvpsstwpsqtvtcsvahpassttvdkkle

Timeline for d1osph2:

• d1osph2 first appeared (with stable ids) in SCOP 1.55
  
• d1osph2 appears in SCOP 1.63
  
• d1osph2 appears in SCOP 1.67
  
• d1osph2 appears in the current release, SCOPe 2.08