Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab 184.1 (mouse), kappa L chain [49036] (1 PDB entry) against OspA |
Domain d1osph2: 1osp H:121-218 [21147] Other proteins in same PDB: d1osph1, d1ospl1, d1ospo_ mutant |
PDB Entry: 1osp (more details), 1.95 Å
SCOP Domain Sequences for d1osph2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1osph2 b.1.1.2 (H:121-218) Immunoglobulin (constant domains of L and H chains) {Fab 184.1 (mouse), kappa L chain} akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg lytmsssvtvpsstwpsqtvtcsvahpassttvdkkle
Timeline for d1osph2: