Lineage for d1osph2 (1osp H:121-218)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221213Species Fab 184.1 (mouse), kappa L chain [49036] (1 PDB entry)
    against OspA
  8. 221214Domain d1osph2: 1osp H:121-218 [21147]
    Other proteins in same PDB: d1osph1, d1ospl1, d1ospo_
    mutant

Details for d1osph2

PDB Entry: 1osp (more details), 1.95 Å

PDB Description: crystal structure of outer surface protein a of borrelia burgdorferi complexed with a murine monoclonal antibody fab

SCOP Domain Sequences for d1osph2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1osph2 b.1.1.2 (H:121-218) Immunoglobulin (constant domains of L and H chains) {Fab 184.1 (mouse), kappa L chain}
akttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsg
lytmsssvtvpsstwpsqtvtcsvahpassttvdkkle

SCOP Domain Coordinates for d1osph2:

Click to download the PDB-style file with coordinates for d1osph2.
(The format of our PDB-style files is described here.)

Timeline for d1osph2: