SCOPe 2.08: Domain d3i4bb_: 3i4b B:

Lineage for d3i4bb_ (3i4b B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (2 species)
   CMGC group; GSK3 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [69824] (57 PDB entries)
   Uniprot P49841 35-383 ! Uniprot P49841 35-384

8. Domain d3i4bb_: 3i4b B: [211469]
   automated match to d1q5ka_
   complexed with z48

Details for d3i4bb_

PDB Entry: 3i4b, 2.3 Å

PDB Description: crystal structure of gsk3b in complex with a pyrimidylpyrrole inhibitor

PDB Compounds: (B:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d3i4bb_:

Sequence; same for both SEQRES and ATOM records:

>d3i4bb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv
iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs
yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt
ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac
ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilippha

Timeline for d3i4bb_:

• d3i4bb_ first appeared in SCOPe 2.03
  
• d3i4bb_ appears in SCOPe 2.07