SCOPe 2.04: Domain d3i4aa_: 3i4a A:

Lineage for d3i4aa_ (3i4a A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (8 families)

5. Family d.126.1.0: automated matches [191334] (1 protein)
   not a true family

6. Protein automated matches [190175] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187904] (6 PDB entries)

8. Domain d3i4aa_: 3i4a A: [211466]
   automated match to d2jajb_
   complexed with ln5

Details for d3i4aa_

PDB Entry: 3i4a, 1.9 Å

PDB Description: crystal structure of dimethylarginine dimethylaminohydrolase-1 (ddah- 1) in complex with n5-(1-iminopropyl)-l-ornithine

PDB Compounds: (A:) N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

SCOPe Domain Sequences for d3i4aa_:

Sequence; same for both SEQRES and ATOM records:

>d3i4aa_ d.126.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpa
deslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatld
ggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnlia
igssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesak
vyeklkdhmlipvsmselekvdglltccsvlinkk

Timeline for d3i4aa_:

• d3i4aa_ first appeared in SCOPe 2.03
  
• d3i4aa_ appears in SCOPe 2.05
  
• d3i4aa_ appears in the current release, SCOPe 2.08