Lineage for d3i44a_ (3i44 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141166Species Bartonella henselae [TaxId:38323] [225730] (1 PDB entry)
  8. 2141167Domain d3i44a_: 3i44 A: [211461]
    automated match to d4fr8h_
    complexed with na, unx

Details for d3i44a_

PDB Entry: 3i44 (more details), 2 Å

PDB Description: Crystal structure of aldehyde dehydrogenase from bartonella henselae at 2.0A resolution
PDB Compounds: (A:) aldehyde dehydrogenase

SCOPe Domain Sequences for d3i44a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i44a_ c.82.1.0 (A:) automated matches {Bartonella henselae [TaxId: 38323]}
mlnkrkfyinglwddpstphdlyvidpsteeacavislgstrdadkainaakkafqtwkt
tspherlgfvekileiyekrssdmaktismemgapidmalnaqtatgsshirnfikayke
fsfqealiegneqailhydaigvvglitpwnwpmnqvtlkvipallagctmvlkpseiap
lsamlfaeildeaalpsgvfnlingdganvgsylsahpdlemisftgstragkdisknas
ntlkrvclelggkganiifadadidalqrgvrhcfynsgqscnaptrmlveqaiydkaik
takdiaektqvgpghqtgnhigpvvskeqydkiqdliqsgidegatlvtggtglpmgmer
gyyvrptvfadvkphmrifreeifgpvlsllpfntedeavtlandteygltnyiqsqdrs
kcrriaaqvrsgmvevnghelpggsyfggvkfsgraregglwgikefldtkaisyw

SCOPe Domain Coordinates for d3i44a_:

Click to download the PDB-style file with coordinates for d3i44a_.
(The format of our PDB-style files is described here.)

Timeline for d3i44a_: