![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
![]() | Protein automated matches [190117] (50 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:272620] [225726] (2 PDB entries) |
![]() | Domain d3i3yb1: 3i3y B:2-285 [211456] Other proteins in same PDB: d3i3ya2, d3i3yb2, d3i3yc2, d3i3yd2 automated match to d2fv7a1 complexed with gol, rib, so4 |
PDB Entry: 3i3y (more details), 2.15 Å
SCOPe Domain Sequences for d3i3yb1:
Sequence, based on SEQRES records: (download)
>d3i3yb1 c.72.1.0 (B:2-285) automated matches {Klebsiella pneumoniae [TaxId: 272620]} rvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaatg ndsngawirqqikneplmllpdghfnqhsdtsiilnsadgdnaiitttaaadtfsldemi phmadavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidiavv neseaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavmlas allrgvapdalalahasraaaitvsrrgtlsafpgsrelaallt
>d3i3yb1 c.72.1.0 (B:2-285) automated matches {Klebsiella pneumoniae [TaxId: 272620]} rvyvtgnitvdetwsipdipkkgasihgvkvsqdiggkganqaiilsrcgietrliaatg ndsngawirqqikneplmllpdghfnqhsdtsiiladgnaiitttaaadtfsldemiphm adavagdillqqgnfsldktralfqyarsrgmttvfnpspvnpdfchlwplidiavvnes eaellqpygvktlvitqgaagawlvqegqrqfcpavpaealdttgagdtflavmlasall rgvapdalalahasraaaitvsrrgtlsafpgsrelaallt
Timeline for d3i3yb1: