SCOP 1.59: Domain d1kemh2: 1kem H:116-218

Lineage for d1kemh2 (1kem H:116-218)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab 28B4 (mouse), kappa L chain [49035] (2 PDB entries)

8. Domain d1kemh2: 1kem H:116-218 [21145]
   Other proteins in same PDB: d1kemh1, d1keml1

Details for d1kemh2

PDB Entry: 1kem, 2.2 Å

PDB Description: catalytic antibody 28b4 fab fragment

SCOP Domain Sequences for d1kemh2:

Sequence; same for both SEQRES and ATOM records:

>d1kemh2 b.1.1.2 (H:116-218) Immunoglobulin (constant domains of L and H chains) {Fab 28B4 (mouse), kappa L chain}
tvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpav
lqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d1kemh2:

• d1kemh2 first appeared (with stable ids) in SCOP 1.55
  
• d1kemh2 appears in SCOP 1.57
  
• d1kemh2 appears in SCOP 1.61
  
• d1kemh2 appears in the current release, SCOPe 2.08