SCOPe 2.03: Domain d3i33a1: 3i33 A:5-189

Lineage for d3i33a1 (3i33 A:5-189)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225574] (12 PDB entries)

8. Domain d3i33a1: 3i33 A:5-189 [211445]
   automated match to d2qw9a1
   complexed with adp, gol, mg, po4

Details for d3i33a1

PDB Entry: 3i33, 1.3 Å

PDB Description: Crystal structure of the human 70kDa heat shock protein 2 (Hsp70-2) ATPase domain in complex with ADP and inorganic phosphate

PDB Compounds: (A:) Heat shock-related 70 kDa protein 2

SCOPe Domain Sequences for d3i33a1:

Sequence; same for both SEQRES and ATOM records:

>d3i33a1 c.55.1.1 (A:5-189) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mpaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnp
tntifdakrligrkfedatvqsdmkhwpfrvvseggkpkvqveykgetktffpeeissmv
ltkmkeiaeaylggkvhsavitvpayfndsqrqatkdagtitglnvlriineptaaaiay
gldkk

Timeline for d3i33a1:

• d3i33a1 is new in SCOPe 2.03-stable
  
• d3i33a1 appears in SCOPe 2.04
  
• d3i33a1 appears in the current release, SCOPe 2.08