Lineage for d3i2ea_ (3i2e A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1668076Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1668077Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1668203Family d.126.1.0: automated matches [191334] (1 protein)
    not a true family
  6. 1668204Protein automated matches [190175] (6 species)
    not a true protein
  7. 1668214Species Human (Homo sapiens) [TaxId:9606] [187904] (6 PDB entries)
  8. 1668217Domain d3i2ea_: 3i2e A: [211443]
    automated match to d2jajb_

Details for d3i2ea_

PDB Entry: 3i2e (more details), 2.03 Å

PDB Description: crystal structure of human dimethylarginine dymethylaminohydrolase-1 (ddah-1)
PDB Compounds: (A:) N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

SCOPe Domain Sequences for d3i2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i2ea_ d.126.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aafgrathavvralpeslgqhalrsakgeevdvaraerqhqlyvgvlgsklglqvvelpa
deslpdcvfvedvavvceetalitrpgapsrrkevdmmkealeklqlnivemkdenatld
ggdvlftgreffvglskrtnqrgaeiladtfkdyavstvpvadglhlksfcsmagpnlia
igssesaqkalkimqqmsdhrydkltvpddiaanciylnipnkghvllhrtpeeypesak
vyeklkdhmlipvsmselekvdglltccsvlinkk

SCOPe Domain Coordinates for d3i2ea_:

Click to download the PDB-style file with coordinates for d3i2ea_.
(The format of our PDB-style files is described here.)

Timeline for d3i2ea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3i2eb_