| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) ![]() bind purine or pterin in topologically similar sites between subunits |
| Family d.96.1.0: automated matches [227243] (1 protein) not a true family |
| Protein automated matches [227009] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225725] (1 PDB entry) |
| Domain d3i2bj_: 3i2b J: [211438] automated match to d2g64a1 complexed with edo, mg, ni, peg |
PDB Entry: 3i2b (more details), 2.3 Å
SCOPe Domain Sequences for d3i2bj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i2bj_ d.96.1.0 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rcqaqvsrrisfsashrlyskflsdeenlklfgkcnnpnghghnykvvvtvhgeidpatg
mvmnladlkkymeeaimqpldhknldmdvpyfadvvsttenvavyiwdnlqkvlpvgvly
kvkvyetdnnivvykge
Timeline for d3i2bj_: