Lineage for d3i2bb_ (3i2b B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2207296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2207860Family d.96.1.0: automated matches [227243] (1 protein)
    not a true family
  6. 2207861Protein automated matches [227009] (13 species)
    not a true protein
  7. 2207978Species Human (Homo sapiens) [TaxId:9606] [225725] (1 PDB entry)
  8. 2207980Domain d3i2bb_: 3i2b B: [211430]
    automated match to d2g64a1
    complexed with edo, mg, ni, peg

Details for d3i2bb_

PDB Entry: 3i2b (more details), 2.3 Å

PDB Description: the crystal structure of human 6 pyruvoyl tetrahydrobiopterin synthase
PDB Compounds: (B:) 6-pyruvoyl tetrahydrobiopterin synthase

SCOPe Domain Sequences for d3i2bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i2bb_ d.96.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rrcqaqvsrrisfsashrlyskflsdeenlklfgkcnnpnghghnykvvvtvhgeidpat
gmvmnladlkkymeeaimqpldhknldmdvpyfadvvsttenvavyiwdnlqkvlpvgvl
ykvkvyetdnnivvykge

SCOPe Domain Coordinates for d3i2bb_:

Click to download the PDB-style file with coordinates for d3i2bb_.
(The format of our PDB-style files is described here.)

Timeline for d3i2bb_: