Lineage for d3i28a2 (3i28 A:228-548)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1383008Family c.69.1.11: Epoxide hydrolase [53525] (2 proteins)
  6. 1383022Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)
  7. 1383023Species Human (Homo sapiens) [TaxId:9606] [102626] (11 PDB entries)
  8. 1383024Domain d3i28a2: 3i28 A:228-548 [211428]
    Other proteins in same PDB: d3i28a1
    automated match to d1vj5a2
    complexed with 34n

Details for d3i28a2

PDB Entry: 3i28 (more details), 1.95 Å

PDB Description: crystal structure of soluble epoxide hydrolase
PDB Compounds: (A:) Epoxide hydrolase 2

SCOPe Domain Sequences for d3i28a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i28a2 c.69.1.11 (A:228-548) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
lptscnpsdmshgyvtvkprvrlhfvelgsgpavclchgfpeswyswryqipalaqagyr
vlamdmkgygessappeieeycmevlckemvtfldklglsqavfighdwggmlvwymalf
ypervravaslntpfipanpnmsplesikanpvfdyqlyfqepgvaeaeleqnlsrtfks
lfrasdesvlsmhkvceagglfvnspeepslsrmvteeeiqfyvqqfkksgfrgplnwyr
nmernwkwackslgrkilipalmvtaekdfvlvpqmsqhmedwiphlkrghiedcghwtq
mdkptevnqilikwldsdarn

SCOPe Domain Coordinates for d3i28a2:

Click to download the PDB-style file with coordinates for d3i28a2.
(The format of our PDB-style files is described here.)

Timeline for d3i28a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3i28a1