Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.2: YihX-like [56789] (2 proteins) the insertion subdomain is a 4-helical bundle automatically mapped to Pfam PF13419 |
Protein Epoxide hydrolase, N-terminal domain [56790] (2 species) has a lipid phosphatase activity |
Species Human (Homo sapiens) [TaxId:9606] [102303] (11 PDB entries) |
Domain d3i28a1: 3i28 A:4-227 [211427] Other proteins in same PDB: d3i28a2 automated match to d1vj5a1 complexed with 34n |
PDB Entry: 3i28 (more details), 1.95 Å
SCOPe Domain Sequences for d3i28a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i28a1 c.108.1.2 (A:4-227) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} raavfdldgvlalpavfgvlgrteealalprgllndafqkggpegattrlmkgeitlsqw iplmeencrkcsetakvclpknfsikeifdkaisarkinrpmlqaalmlrkkgfttailt ntwlddraerdglaqlmcelkmhfdfliescqvgmvkpepqiykflldtlkaspsevvfl ddiganlkpardlgmvtilvqdtdtalkelekvtgiqllntpap
Timeline for d3i28a1: