SCOPe 2.03: Domain d3i12c1: 3i12 C:2-139

Lineage for d3i12c1 (3i12 C:2-139)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (19 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [225723] (1 PDB entry)

8. Domain d3i12c1: 3i12 C:2-139 [211421]
   Other proteins in same PDB: d3i12a2, d3i12b2, d3i12c2, d3i12d2
   automated match to d1ehib1
   complexed with adp

Details for d3i12c1

PDB Entry: 3i12, 2.2 Å

PDB Description: The crystal structure of the D-alanyl-alanine synthetase A from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

PDB Compounds: (C:) D-alanine-D-alanine ligase A

SCOPe Domain Sequences for d3i12c1:

Sequence; same for both SEQRES and ATOM records:

>d3i12c1 c.30.1.0 (C:2-139) automated matches {Salmonella typhimurium [TaxId: 90371]}
aklrvgivfggksaehevslqsaknivdaidktrfdvvllgidkagqwhvndaenylqna
ddpahialrpsaislaqvpgkhqhqlinaqngqplptvdvifpivhgtlgedgslqgmlr
vanlpfvgsdvlssaacm

Timeline for d3i12c1:

• d3i12c1 is new in SCOPe 2.03-stable
  
• d3i12c1 appears in SCOPe 2.04
  
• d3i12c1 appears in the current release, SCOPe 2.08