Lineage for d3i12a1 (3i12 A:2-139)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862467Species Salmonella typhimurium [TaxId:90371] [225723] (1 PDB entry)
  8. 2862468Domain d3i12a1: 3i12 A:2-139 [211417]
    Other proteins in same PDB: d3i12a2, d3i12b2, d3i12c2, d3i12d2
    automated match to d1ehib1
    complexed with adp

Details for d3i12a1

PDB Entry: 3i12 (more details), 2.2 Å

PDB Description: The crystal structure of the D-alanyl-alanine synthetase A from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
PDB Compounds: (A:) D-alanine-D-alanine ligase A

SCOPe Domain Sequences for d3i12a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i12a1 c.30.1.0 (A:2-139) automated matches {Salmonella typhimurium [TaxId: 90371]}
aklrvgivfggksaehevslqsaknivdaidktrfdvvllgidkagqwhvndaenylqna
ddpahialrpsaislaqvpgkhqhqlinaqngqplptvdvifpivhgtlgedgslqgmlr
vanlpfvgsdvlssaacm

SCOPe Domain Coordinates for d3i12a1:

Click to download the PDB-style file with coordinates for d3i12a1.
(The format of our PDB-style files is described here.)

Timeline for d3i12a1: