SCOPe 2.08: Domain d3i02c1: 3i02 C:1-106

Lineage for d3i02c1 (3i02 C:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3i02c1: 3i02 C:1-106 [211412]
   Other proteins in same PDB: d3i02a2, d3i02b_, d3i02c2, d3i02d_
   automated match to d1dqdl1

Details for d3i02c1

PDB Entry: 3i02, 2.6 Å

PDB Description: crystal structure of s54-10 antibody in complex with antigen kdo(2.4) kdo(2.4)kdo

PDB Compounds: (C:) immunoglobulin light chain

SCOPe Domain Sequences for d3i02c1:

Sequence; same for both SEQRES and ATOM records:

>d3i02c1 b.1.1.0 (C:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkllifwastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsynlrtfgrgtkleik

Timeline for d3i02c1:

• d3i02c1 first appeared in SCOPe 2.03
  
• d3i02c1 appears in SCOPe 2.07