SCOP 1.63: Domain d1nldh2: 1nld H:113-215

Lineage for d1nldh2 (1nld H:113-215)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 1583, against an epitope of gp41 of HIV-1, (mouse), kappa L chain [49034] (1 PDB entry)

8. Domain d1nldh2: 1nld H:113-215 [21141]
   Other proteins in same PDB: d1nldh1, d1nldl1

Details for d1nldh2

PDB Entry: 1nld, 2.9 Å

PDB Description: fab fragment of a neutralizing antibody directed against an epitope of gp41 from hiv-1

SCOP Domain Sequences for d1nldh2:

Sequence; same for both SEQRES and ATOM records:

>d1nldh2 b.1.1.2 (H:113-215) Immunoglobulin (constant domains of L and H chains) {Fab 1583, against an epitope of gp41 of HIV-1, (mouse), kappa L chain}
sasttapsvyplapvsgdqtnssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsspwpsetitcnvahpasstkvdkkieprgc

Timeline for d1nldh2:

• d1nldh2 first appeared (with stable ids) in SCOP 1.55
  
• d1nldh2 appears in SCOP 1.61
  
• d1nldh2 appears in SCOP 1.65
  
• d1nldh2 appears in the current release, SCOPe 2.08