Lineage for d3hzya2 (3hzy A:107-210)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1763774Domain d3hzya2: 3hzy A:107-210 [211409]
    Other proteins in same PDB: d3hzya1
    automated match to d1dqdl2
    complexed with mg, zn

Details for d3hzya2

PDB Entry: 3hzy (more details), 2.1 Å

PDB Description: crystal structure of s73-2 antibody in complex with antigen kdo(2.4) kdo(2.4)kdo
PDB Compounds: (A:) S73-2 Fab (IgG1k) light chain

SCOPe Domain Sequences for d3hzya2:

Sequence, based on SEQRES records: (download)

>d3hzya2 b.1.1.2 (A:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdiavkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

Sequence, based on observed residues (ATOM records): (download)

>d3hzya2 b.1.1.2 (A:107-210) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdiavkwkidgserngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d3hzya2:

Click to download the PDB-style file with coordinates for d3hzya2.
(The format of our PDB-style files is described here.)

Timeline for d3hzya2: