SCOPe 2.08: Domain d3hybb1: 3hyb B:1-105

Lineage for d3hybb1 (3hyb B:1-105)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.280: RbcX-like [158614] (1 superfamily)
   5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer

4. Superfamily a.280.1: RbcX-like [158615] (2 families)

5. Family a.280.1.1: RbcX-like [158616] (1 protein)
   Pfam PF02341 (note typo in the Pfam name: RcbX)

6. Protein RuBisCo chaperone RbcX [158617] (5 species)

7. Species Anabaena sp. [TaxId:1167] [158619] (2 PDB entries)
   Uniprot Q44212 1-115

8. Domain d3hybb1: 3hyb B:1-105 [211399]
   Other proteins in same PDB: d3hyba2, d3hybb2
   automated match to d2peoa1
   complexed with so4

Details for d3hybb1

PDB Entry: 3hyb, 2.3 Å

PDB Description: Crystal structure of RbcX from Anabaena, crystal form II

PDB Compounds: (B:) RbcX protein

SCOPe Domain Sequences for d3hybb1:

Sequence; same for both SEQRES and ATOM records:

>d3hybb1 a.280.1.1 (B:1-105) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvqdgekyieelf
lekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhl

Timeline for d3hybb1:

• d3hybb1 first appeared in SCOPe 2.03, called d3hybb_
  
• d3hybb1 appears in SCOPe 2.07