| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.280: RbcX-like [158614] (1 superfamily) 5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer |
Superfamily a.280.1: RbcX-like [158615] (2 families) ![]() |
| Family a.280.1.1: RbcX-like [158616] (1 protein) Pfam PF02341 (note typo in the Pfam name: RcbX) |
| Protein RuBisCo chaperone RbcX [158617] (5 species) |
| Species Anabaena sp. [TaxId:1167] [158619] (2 PDB entries) Uniprot Q44212 1-115 |
| Domain d3hyba1: 3hyb A:1-105 [211398] Other proteins in same PDB: d3hyba2, d3hybb2 automated match to d2peoa1 complexed with so4 |
PDB Entry: 3hyb (more details), 2.3 Å
SCOPe Domain Sequences for d3hyba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hyba1 a.280.1.1 (A:1-105) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvqdgekyieelf
lekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhl
Timeline for d3hyba1: