Lineage for d3hyba1 (3hyb A:1-105)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739026Fold a.280: RbcX-like [158614] (1 superfamily)
    5 helices per subunit; irregular array of short and long helices; swapping of the C-terminal helices in the dimer
  4. 2739027Superfamily a.280.1: RbcX-like [158615] (2 families) (S)
  5. 2739028Family a.280.1.1: RbcX-like [158616] (1 protein)
    Pfam PF02341 (note typo in the Pfam name: RcbX)
  6. 2739029Protein RuBisCo chaperone RbcX [158617] (5 species)
  7. 2739030Species Anabaena sp. [TaxId:1167] [158619] (2 PDB entries)
    Uniprot Q44212 1-115
  8. 2739031Domain d3hyba1: 3hyb A:1-105 [211398]
    Other proteins in same PDB: d3hyba2, d3hybb2
    automated match to d2peoa1
    complexed with so4

Details for d3hyba1

PDB Entry: 3hyb (more details), 2.3 Å

PDB Description: Crystal structure of RbcX from Anabaena, crystal form II
PDB Compounds: (A:) RbcX protein

SCOPe Domain Sequences for d3hyba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hyba1 a.280.1.1 (A:1-105) RuBisCo chaperone RbcX {Anabaena sp. [TaxId: 1167]}
mnlkqiakdtaktlqsyltyqalrtvlaqlgetnpplalwlhnfsagkvqdgekyieelf
lekpdlalrimtvrehiaeeiaeflpemvvtgiqqanmekrrqhl

SCOPe Domain Coordinates for d3hyba1:

Click to download the PDB-style file with coordinates for d3hyba1.
(The format of our PDB-style files is described here.)

Timeline for d3hyba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hyba2