![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (5 PDB entries) |
![]() | Domain d1clzh2: 1clz H:115-231 [21137] Other proteins in same PDB: d1clzh1, d1clzl1, d1clzl2 part of Fab MBR96 from murine ascites complexed with fuc, gal, nag, non |
PDB Entry: 1clz (more details), 2.8 Å
SCOP Domain Sequences for d1clzh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clzh2 b.1.1.2 (H:115-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3} tttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgf yslsslvtvpsstwpsqtvicnvahpasktelikriepr
Timeline for d1clzh2: