SCOPe 2.08: Domain d1clzh2: 1clz H:115-231

Lineage for d1clzh2 (1clz H:115-231)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
   Uniprot P22436 # GC3_MOUSE (P22436) Ig gamma-3 chain C region

8. Domain d1clzh2: 1clz H:115-231 [21137]
   Other proteins in same PDB: d1clzh1, d1clzl1, d1clzl2
   part of Fab MBR96
   from murine ascites
   complexed with non

Details for d1clzh2

PDB Entry: 1clz, 2.8 Å

PDB Description: igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester

PDB Compounds: (H:) igg fab (igg3, kappa)

SCOPe Domain Sequences for d1clzh2:

Sequence; same for both SEQRES and ATOM records:

>d1clzh2 b.1.1.2 (H:115-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
tttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsgf
yslsslvtvpsstwpsqtvicnvahpasktelikriepr

Timeline for d1clzh2:

• d1clzh2 first appeared (with stable ids) in SCOP 1.55
  
• d1clzh2 appears in SCOPe 2.07