![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein (Apo)ferritin [47246] (8 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187702] (9 PDB entries) |
![]() | Domain d3hx5n_: 3hx5 N: [211361] Other proteins in same PDB: d3hx5a2, d3hx5b2, d3hx5d2, d3hx5r2, d3hx5s2, d3hx5u2 complexed with ca; mutant complexed with ca; mutant |
PDB Entry: 3hx5 (more details), 2.85 Å
SCOPe Domain Sequences for d3hx5n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hx5n_ a.25.1.1 (N:) (Apo)ferritin {Human (Homo sapiens) [TaxId: 9606]} ssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekre gyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsar tdphlcdflethfldeevklikkmgdhltnlhrlggpea
Timeline for d3hx5n_:
![]() Domains from other chains: (mouse over for more information) d3hx5a1, d3hx5a2, d3hx5b1, d3hx5b2, d3hx5c_, d3hx5d1, d3hx5d2, d3hx5e_, d3hx5f_, d3hx5g_, d3hx5h_, d3hx5i_, d3hx5j_, d3hx5k_, d3hx5l_, d3hx5m_, d3hx5o_, d3hx5p_, d3hx5q_, d3hx5r1, d3hx5r2, d3hx5s1, d3hx5s2, d3hx5t_, d3hx5u1, d3hx5u2, d3hx5v_, d3hx5w_, d3hx5x_ |