SCOP 1.63: Domain d1clzl2: 1clz L:109-214

Lineage for d1clzl2 (1clz L:109-214)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab MBR96 (mouse), kappa L chain [49032] (1 PDB entry)

8. Domain d1clzl2: 1clz L:109-214 [21136]
   Other proteins in same PDB: d1clzh1, d1clzl1

Details for d1clzl2

PDB Entry: 1clz, 2.8 Å

PDB Description: igg fab (igg3, kappa) fragment (mbr96) complexed with lewis y nonoate methyl ester

SCOP Domain Sequences for d1clzl2:

Sequence; same for both SEQRES and ATOM records:

>d1clzl2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Fab MBR96 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1clzl2:

• d1clzl2 first appeared (with stable ids) in SCOP 1.55
  
• d1clzl2 appears in SCOP 1.61
  
• d1clzl2 appears in SCOP 1.65
  
• d1clzl2 appears in the current release, SCOPe 2.08