Lineage for d1clyl2 (1cly L:109-214)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2360179Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2360180Species Human (Homo sapiens) [TaxId:9606] [88569] (151 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2360286Domain d1clyl2: 1cly L:109-214 [21134]
    Other proteins in same PDB: d1clyh1, d1clyh2, d1clyl1
    part of humanized Fab CBR96
    complexed with non

Details for d1clyl2

PDB Entry: 1cly (more details), 2.5 Å

PDB Description: igg fab (human igg1, kappa) chimeric fragment (cbr96) complexed with lewis y nonoate methyl ester
PDB Compounds: (L:) igg fab (human igg1, kappa)

SCOPe Domain Sequences for d1clyl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clyl2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d1clyl2:

Click to download the PDB-style file with coordinates for d1clyl2.
(The format of our PDB-style files is described here.)

Timeline for d1clyl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clyl1