Lineage for d1clyl2 (1cly L:109-214)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53672Species Fab CBR96 (mouse/human), kappa L chain [49031] (2 PDB entries)
  8. 53676Domain d1clyl2: 1cly L:109-214 [21134]
    Other proteins in same PDB: d1clyh1, d1clyl1

Details for d1clyl2

PDB Entry: 1cly (more details), 2.5 Å

PDB Description: igg fab (human igg1, kappa) chimeric fragment (cbr96) complexed with lewis y nonoate methyl ester

SCOP Domain Sequences for d1clyl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1clyl2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Fab CBR96 (mouse/human), kappa L chain}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1clyl2:

Click to download the PDB-style file with coordinates for d1clyl2.
(The format of our PDB-style files is described here.)

Timeline for d1clyl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1clyl1