SCOP 1.55: Domain d1ucbh2: 1ucb H:114-227

Lineage for d1ucbh2 (1ucb H:114-227)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab CBR96 (mouse/human), kappa L chain [49031] (2 PDB entries)

8. Domain d1ucbh2: 1ucb H:114-227 [21133]
   Other proteins in same PDB: d1ucbh1, d1ucbl1

Details for d1ucbh2

PDB Entry: 1ucb, 2.5 Å

PDB Description: structure of uncomplexed fab compared to complex (1cly, 1clz)

SCOP Domain Sequences for d1ucbh2:

Sequence; same for both SEQRES and ATOM records:

>d1ucbh2 b.1.1.2 (H:114-227) Immunoglobulin (constant domains of L and H chains) {Fab CBR96 (mouse/human), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Timeline for d1ucbh2:

• d1ucbh2 appears in SCOP 1.57
  
• d1ucbh2 appears in the current release, SCOPe 2.07