Lineage for d3hwga_ (3hwg A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324200Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1324344Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 1324345Species Human (Homo sapiens) [TaxId:9606] [50836] (28 PDB entries)
  8. 1324368Domain d3hwga_: 3hwg A: [211321]
    automated match to d4iawa_
    complexed with cl, fe, gol, na, qed, so4

Details for d3hwga_

PDB Entry: 3hwg (more details), 2.19 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with fe-trencam-hopo2
PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3hwga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hwga_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
tsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedks
ynvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvff
kkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

SCOPe Domain Coordinates for d3hwga_:

Click to download the PDB-style file with coordinates for d3hwga_.
(The format of our PDB-style files is described here.)

Timeline for d3hwga_: