| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody |
| Domain d1ucbl2: 1ucb L:109-214 [21132] Other proteins in same PDB: d1ucbh1, d1ucbh2, d1ucbl1 part of humanized Fab CBR96 complexed with so4 |
PDB Entry: 1ucb (more details), 2.5 Å
SCOPe Domain Sequences for d1ucbl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ucbl2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1ucbl2: