SCOPe 2.03: Domain d3hweb_: 3hwe B:

Lineage for d3hweb_ (3hwe B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (28 PDB entries)

8. Domain d3hweb_: 3hwe B: [211319]
   automated match to d4iawa_
   complexed with fe, gol, na, rks, so4

Details for d3hweb_

PDB Entry: 3hwe, 2.8 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with fe-bishacam

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3hweb_:

Sequence, based on SEQRES records:

>d3hweb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcid

Sequence, based on observed residues (ATOM records):

>d3hweb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkellkenfirfskslglpenhivfpvpidqcid

Timeline for d3hweb_:

• d3hweb_ is new in SCOPe 2.03-stable
  
• d3hweb_ appears in SCOPe 2.04
  
• d3hweb_ appears in the current release, SCOPe 2.08