SCOPe 2.07: Domain d3hwda_: 3hwd A:

Lineage for d3hwda_ (3hwd A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (50 PDB entries)

8. Domain d3hwda_: 3hwd A: [211315]
   automated match to d4iawa_
   complexed with na; mutant

Details for d3hwda_

PDB Entry: 3hwd, 2.95 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) k125a-k134a mutant complexed with ferric enterobactin

PDB Compounds: (A:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3hwda_:

Sequence; same for both SEQRES and ATOM records:

>d3hwda_ b.60.1.1 (A:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
stsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedk
synvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvf
fkavsqnreyfaitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Timeline for d3hwda_:

• d3hwda_ first appeared in SCOPe 2.03
  
• d3hwda_ appears in SCOPe 2.06
  
• d3hwda_ appears in the current release, SCOPe 2.08