Lineage for d3hvuc1 (3hvu C:1-179)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2891884Species Bacillus anthracis [TaxId:261594] [189450] (7 PDB entries)
  8. 2891896Domain d3hvuc1: 3hvu C:1-179 [211311]
    Other proteins in same PDB: d3hvua2, d3hvub2, d3hvuc2, d3hvud2
    automated match to d1r3ub_
    complexed with mes, na

Details for d3hvuc1

PDB Entry: 3hvu (more details), 1.95 Å

PDB Description: 1.95 angstrom crystal structure of complex of hypoxanthine-guanine phosphoribosyltransferase from bacillus anthracis with 2-(n- morpholino)ethanesulfonic acid (mes)
PDB Compounds: (C:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d3hvuc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hvuc1 c.61.1.0 (C:1-179) automated matches {Bacillus anthracis [TaxId: 261594]}
mmnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdtyl
emdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrka
ksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys

SCOPe Domain Coordinates for d3hvuc1:

Click to download the PDB-style file with coordinates for d3hvuc1.
(The format of our PDB-style files is described here.)

Timeline for d3hvuc1: