| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
| Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
| Protein automated matches [190891] (38 species) not a true protein |
| Species Bacillus anthracis [TaxId:261594] [189450] (7 PDB entries) |
| Domain d3hvuc1: 3hvu C:1-179 [211311] Other proteins in same PDB: d3hvua2, d3hvub2, d3hvuc2, d3hvud2 automated match to d1r3ub_ complexed with mes, na |
PDB Entry: 3hvu (more details), 1.95 Å
SCOPe Domain Sequences for d3hvuc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hvuc1 c.61.1.0 (C:1-179) automated matches {Bacillus anthracis [TaxId: 261594]}
mmnqdiekvliseeqiqekvlelgaiiaedykntvplaigvlkgampfmadllkrtdtyl
emdfmavssyghstvstgevkilkdldtsvegrdilivediidsgltlsylvdlfkyrka
ksvkivtlldkptgrkvdlkadyvgftvphefvvgygldykeqyrnlpyvgvlkpsvys
Timeline for d3hvuc1: