SCOP 1.65: Domain d1yuhb2: 1yuh B:119-218

Lineage for d1yuhb2 (1yuh B:119-218)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
Domain d1yuhb2: 1yuh B:119-218 [21131]
Other proteins in same PDB: d1yuha1, d1yuha2, d1yuhb1, d1yuhh1, d1yuhl1, d1yuhl2
part of an anti-nitrophenol Fab
complexed with np

Details for d1yuhb2

PDB Description: fab fragment

SCOP Domain Sequences for d1yuhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yuhb2 b.1.1.2 (B:119-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
aattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsd
lytlsssvtvpastwpsgtvtcnvahpasstavdkkivpr

SCOP Domain Coordinates for d1yuhb2:

Click to download the PDB-style file with coordinates for d1yuhb2.
(The format of our PDB-style files is described here.)

Timeline for d1yuhb2: