| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries) |
| Domain d1yuhb2: 1yuh B:119-218 [21131] Other proteins in same PDB: d1yuha1, d1yuha2, d1yuhb1, d1yuhh1, d1yuhl1, d1yuhl2 part of an anti-nitrophenol Fab complexed with np |
PDB Entry: 1yuh (more details), 3 Å
SCOP Domain Sequences for d1yuhb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yuhb2 b.1.1.2 (B:119-218) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
aattppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsd
lytlsssvtvpastwpsgtvtcnvahpasstavdkkivpr
Timeline for d1yuhb2: