SCOPe 2.08: Domain d3hvqa_: 3hvq A:

Lineage for d3hvqa_ (3hvq A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein automated matches [190344] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187171] (10 PDB entries)

8. Domain d3hvqa_: 3hvq A: [211307]
   automated match to d1s70a_
   complexed with gol, mn, po4

Details for d3hvqa_

PDB Entry: 3hvq, 2.2 Å

PDB Description: Crystal structure of a complex between Protein Phosphatase 1 alpha (PP1) and the PP1 binding and PDZ domains of Neurabin

PDB Compounds: (A:) Serine/threonine-protein phosphatase PP1-alpha catalytic subunit

SCOPe Domain Sequences for d3hvqa_:

Sequence; same for both SEQRES and ATOM records:

>d3hvqa_ d.159.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnldsiigrllevqgsrpgknvqlteneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvqgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpad

Timeline for d3hvqa_:

• d3hvqa_ first appeared in SCOPe 2.03
  
• d3hvqa_ appears in SCOPe 2.07