Lineage for d3huia_ (3hui A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1403183Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1403496Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 1403497Protein automated matches [191164] (9 species)
    not a true protein
  7. 1403519Species Rhodopseudomonas palustris [TaxId:1076] [225824] (1 PDB entry)
  8. 1403520Domain d3huia_: 3hui A: [211306]
    automated match to d3lb8c_
    complexed with fes; mutant

Details for d3huia_

PDB Entry: 3hui (more details), 2.01 Å

PDB Description: Crystal Structure of the mutant A105R of [2Fe-2S] Ferredoxin in the Class I CYP199A2 System from Rhodopseudomonas palustris
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d3huia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3huia_ d.15.4.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
vprgshmakinfvdhtgetrtveveegatvmeaairnaipgveaecggacacatchvyvd
eawrekvggpspmeedmldfgydvrpnsrlscqikvsneldglivttperqr

SCOPe Domain Coordinates for d3huia_:

Click to download the PDB-style file with coordinates for d3huia_.
(The format of our PDB-style files is described here.)

Timeline for d3huia_: